Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441

  1. Avatar for tokens
    1. tokens Lv 1
    100 pts. 9,385
  2. Avatar for Deleted player 2. Deleted player pts. 9,384
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 95 pts. 9,360
  4. Avatar for hansvandenhof 4. hansvandenhof Lv 1 93 pts. 9,353
  5. Avatar for Galaxie 5. Galaxie Lv 1 90 pts. 9,310
  6. Avatar for Susume 6. Susume Lv 1 87 pts. 9,290
  7. Avatar for markm457 7. markm457 Lv 1 85 pts. 9,275
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 83 pts. 9,222
  9. Avatar for jermainiac 9. jermainiac Lv 1 80 pts. 9,212
  10. Avatar for gitwut 10. gitwut Lv 1 78 pts. 9,183

Comments