Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441

  1. Avatar for phi16
    1. phi16 Lv 1
    100 pts. 9,390
  2. Avatar for Galaxie 2. Galaxie Lv 1 85 pts. 9,389
  3. Avatar for jermainiac 3. jermainiac Lv 1 72 pts. 9,379
  4. Avatar for Deleted player 4. Deleted player pts. 9,374
  5. Avatar for reefyrob 5. reefyrob Lv 1 51 pts. 9,372
  6. Avatar for lamoille 6. lamoille Lv 1 42 pts. 9,369
  7. Avatar for LociOiling 7. LociOiling Lv 1 35 pts. 9,369
  8. Avatar for smilingone 8. smilingone Lv 1 28 pts. 9,368
  9. Avatar for alcor29 9. alcor29 Lv 1 23 pts. 9,365
  10. Avatar for alwen 10. alwen Lv 1 19 pts. 9,359

Comments