Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for hansvandenhof 11. hansvandenhof Lv 1 15 pts. 9,356
  2. Avatar for bertro 12. bertro Lv 1 12 pts. 9,355
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 9 pts. 9,354
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 7 pts. 9,195
  5. Avatar for mimi 15. mimi Lv 1 5 pts. 9,185
  6. Avatar for georg137 16. georg137 Lv 1 4 pts. 9,183
  7. Avatar for gitwut 17. gitwut Lv 1 3 pts. 9,181
  8. Avatar for actiasluna 18. actiasluna Lv 1 2 pts. 9,179
  9. Avatar for Blipperman 19. Blipperman Lv 1 2 pts. 9,178
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 1 pt. 9,175

Comments