Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843
  1. Avatar for spvincent 21. spvincent Lv 1 1 pt. 9,172
  2. Avatar for ManVsYard 22. ManVsYard Lv 1 1 pt. 9,169
  3. Avatar for andrewxc 23. andrewxc Lv 1 1 pt. 9,168
  4. Avatar for smholst 24. smholst Lv 1 1 pt. 9,167
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 1 pt. 9,157
  6. Avatar for pauldunn 26. pauldunn Lv 1 1 pt. 9,152
  7. Avatar for Paulo Roque 27. Paulo Roque Lv 1 1 pt. 9,135
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 1 pt. 9,075
  9. Avatar for dbuske 29. dbuske Lv 1 1 pt. 9,032
  10. Avatar for Hollinas 30. Hollinas Lv 1 1 pt. 9,029

Comments