Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843

  1. Avatar for Wilm 11. Wilm Lv 1 76 pts. 9,159
  2. Avatar for LociOiling 12. LociOiling Lv 1 74 pts. 9,156
  3. Avatar for bertro 13. bertro Lv 1 72 pts. 9,130
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 70 pts. 9,128
  5. Avatar for kabubi 15. kabubi Lv 1 68 pts. 9,116
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 66 pts. 9,115
  7. Avatar for reefyrob 17. reefyrob Lv 1 64 pts. 9,110
  8. Avatar for hpaege 18. hpaege Lv 1 62 pts. 9,106
  9. Avatar for eusair 19. eusair Lv 1 60 pts. 9,101
  10. Avatar for spvincent 20. spvincent Lv 1 58 pts. 9,074

Comments