Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,390
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,372
  3. Avatar for Contenders 3. Contenders 58 pts. 9,195
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 9,179
  5. Avatar for Go Science 5. Go Science 31 pts. 9,159
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,116
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,005
  8. Avatar for Deleted group 8. Deleted group pts. 8,902
  9. Avatar for xkcd 9. xkcd 7 pts. 8,868
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 8,843

  1. Avatar for georg137 71. georg137 Lv 1 9 pts. 8,711
  2. Avatar for MicElephant 72. MicElephant Lv 1 9 pts. 8,690
  3. Avatar for manu8170 73. manu8170 Lv 1 9 pts. 8,690
  4. Avatar for alcor29 74. alcor29 Lv 1 8 pts. 8,687
  5. Avatar for Pibeagles 75. Pibeagles Lv 1 8 pts. 8,682
  6. Avatar for tarimo 76. tarimo Lv 1 8 pts. 8,675
  7. Avatar for YGK 77. YGK Lv 1 7 pts. 8,671
  8. Avatar for andrewtmaxwell 78. andrewtmaxwell Lv 1 7 pts. 8,661
  9. Avatar for pfirth 79. pfirth Lv 1 7 pts. 8,659
  10. Avatar for stomjoh 80. stomjoh Lv 1 6 pts. 8,659

Comments