Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 6 pts. 9,020
  2. Avatar for Cannabis Crew 12. Cannabis Crew 4 pts. 8,854
  3. Avatar for xkcd 13. xkcd 3 pts. 8,749
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,713
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,490
  6. Avatar for Kotocycle 16. Kotocycle 1 pt. 8,461
  7. Avatar for :) 17. :) 1 pt. 8,411
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 8,243
  9. Avatar for freefolder 19. freefolder 1 pt. 8,167
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,977

  1. Avatar for andrewxc 101. andrewxc Lv 1 3 pts. 8,513
  2. Avatar for dssb 102. dssb Lv 1 3 pts. 8,497
  3. Avatar for pooja chennupati 103. pooja chennupati Lv 1 3 pts. 8,490
  4. Avatar for gu14003 104. gu14003 Lv 1 3 pts. 8,482
  5. Avatar for Randolph_M_Snyder 105. Randolph_M_Snyder Lv 1 3 pts. 8,463
  6. Avatar for Ikuso 106. Ikuso Lv 1 3 pts. 8,461
  7. Avatar for froggs554 107. froggs554 Lv 1 3 pts. 8,460
  8. Avatar for JUMELLE54 108. JUMELLE54 Lv 1 2 pts. 8,455
  9. Avatar for Nick_Flamel 109. Nick_Flamel Lv 1 2 pts. 8,450
  10. Avatar for Simek 110. Simek Lv 1 2 pts. 8,446

Comments