Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Deleted group 23. Deleted group pts. 7,519
  3. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466

  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 9,593
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 98 pts. 9,563
  3. Avatar for markm457 3. markm457 Lv 1 96 pts. 9,558
  4. Avatar for bertro 4. bertro Lv 1 93 pts. 9,521
  5. Avatar for LociOiling 5. LociOiling Lv 1 91 pts. 9,516
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 88 pts. 9,505
  7. Avatar for reefyrob 7. reefyrob Lv 1 86 pts. 9,500
  8. Avatar for johnmitch 8. johnmitch Lv 1 84 pts. 9,474
  9. Avatar for pmdpmd 9. pmdpmd Lv 1 82 pts. 9,473
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 80 pts. 9,473

Comments