Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 7,545
  3. Avatar for Deleted group 23. Deleted group pts. 7,519
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466
  1. Avatar for aspadistra 141. aspadistra Lv 1 1 pt. 7,977
  2. Avatar for Kiwegapa 142. Kiwegapa Lv 1 1 pt. 7,968
  3. Avatar for SaraL 143. SaraL Lv 1 1 pt. 7,963
  4. Avatar for cdearaujo 144. cdearaujo Lv 1 1 pt. 7,956
  5. Avatar for martinf 145. martinf Lv 1 1 pt. 7,930
  6. Avatar for cnhrcolemam 146. cnhrcolemam Lv 1 1 pt. 7,928
  7. Avatar for yashoda 147. yashoda Lv 1 1 pt. 7,925
  8. Avatar for darioarena 148. darioarena Lv 1 1 pt. 7,854
  9. Avatar for fishercat 149. fishercat Lv 1 1 pt. 7,847
  10. Avatar for kvasirthewise 150. kvasirthewise Lv 1 1 pt. 7,843

Comments