Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 7,545
  3. Avatar for Deleted group 23. Deleted group pts. 7,519
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466
  1. Avatar for Shivine 151. Shivine Lv 1 1 pt. 7,836
  2. Avatar for fuuxd 152. fuuxd Lv 1 1 pt. 7,829
  3. Avatar for Kosc hti 153. Kosc hti Lv 1 1 pt. 7,813
  4. Avatar for parsnip 154. parsnip Lv 1 1 pt. 7,771
  5. Avatar for BIO257C-dguzman 155. BIO257C-dguzman Lv 1 1 pt. 7,747
  6. Avatar for 64SciOne 156. 64SciOne Lv 1 1 pt. 7,726
  7. Avatar for BIO257C-mramirez 157. BIO257C-mramirez Lv 1 1 pt. 7,717
  8. Avatar for trentis1 158. trentis1 Lv 1 1 pt. 7,692
  9. Avatar for BIO257C-ncorrales 159. BIO257C-ncorrales Lv 1 1 pt. 7,685
  10. Avatar for Lucky777 160. Lucky777 Lv 1 1 pt. 7,664

Comments