Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 7,545
  3. Avatar for Deleted group 23. Deleted group pts. 7,519
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466
  1. Avatar for AnthElia 171. AnthElia Lv 1 1 pt. 7,519
  2. Avatar for qw3rtz 172. qw3rtz Lv 1 1 pt. 7,511
  3. Avatar for groudit 173. groudit Lv 1 1 pt. 7,494
  4. Avatar for Alekhya.vytla 174. Alekhya.vytla Lv 1 1 pt. 7,477
  5. Avatar for doctaven 175. doctaven Lv 1 1 pt. 7,466
  6. Avatar for TheSomnambulist 176. TheSomnambulist Lv 1 1 pt. 7,464
  7. Avatar for emtonsti 177. emtonsti Lv 1 1 pt. 7,440
  8. Avatar for JoJack 178. JoJack Lv 1 1 pt. 7,429
  9. Avatar for justjustin 179. justjustin Lv 1 1 pt. 7,404
  10. Avatar for Someporn 180. Someporn Lv 1 1 pt. 7,257

Comments