Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Deleted group 23. Deleted group pts. 7,519
  3. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466

  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 59 pts. 9,435
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 57 pts. 9,423
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 56 pts. 9,417
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 54 pts. 9,416
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 53 pts. 9,412
  6. Avatar for toshiue 26. toshiue Lv 1 51 pts. 9,403
  7. Avatar for KarenCH 27. KarenCH Lv 1 50 pts. 9,398
  8. Avatar for Tehnologik1 28. Tehnologik1 Lv 1 48 pts. 9,396
  9. Avatar for hansvandenhof 29. hansvandenhof Lv 1 47 pts. 9,396
  10. Avatar for jermainiac 30. jermainiac Lv 1 46 pts. 9,390

Comments