Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Deleted group 23. Deleted group pts. 7,519
  3. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466

  1. Avatar for Deleted player 41. Deleted player pts. 9,332
  2. Avatar for Formula350 42. Formula350 Lv 1 32 pts. 9,331
  3. Avatar for crpainter 43. crpainter Lv 1 31 pts. 9,324
  4. Avatar for Norrjane 44. Norrjane Lv 1 30 pts. 9,311
  5. Avatar for smilingone 45. smilingone Lv 1 29 pts. 9,311
  6. Avatar for smholst 46. smholst Lv 1 28 pts. 9,308
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 27 pts. 9,301
  8. Avatar for nicobul 48. nicobul Lv 1 26 pts. 9,298
  9. Avatar for NinjaGreg 49. NinjaGreg Lv 1 25 pts. 9,284
  10. Avatar for pvc78 50. pvc78 Lv 1 24 pts. 9,275

Comments