Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 7,747
  2. Avatar for Deleted group 23. Deleted group pts. 7,519
  3. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,466

  1. Avatar for alwen 61. alwen Lv 1 17 pts. 9,135
  2. Avatar for D001x_ErlandStevens 62. D001x_ErlandStevens Lv 1 16 pts. 9,125
  3. Avatar for MicElephant 63. MicElephant Lv 1 16 pts. 9,115
  4. Avatar for pfirth 64. pfirth Lv 1 15 pts. 9,115
  5. Avatar for teraflop 65. teraflop Lv 1 15 pts. 9,113
  6. Avatar for tarimo 66. tarimo Lv 1 14 pts. 9,106
  7. Avatar for deLaCeiba 67. deLaCeiba Lv 1 14 pts. 9,102
  8. Avatar for phi16 68. phi16 Lv 1 13 pts. 9,093
  9. Avatar for Museka 69. Museka Lv 1 13 pts. 9,073
  10. Avatar for jamiexq 70. jamiexq Lv 1 12 pts. 9,071

Comments