Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102
  1. Avatar for Deleted player 11. Deleted player pts. 9,523
  2. Avatar for O Seki To 12. O Seki To Lv 1 10 pts. 9,518
  3. Avatar for LociOiling 13. LociOiling Lv 1 7 pts. 9,518
  4. Avatar for smilingone 14. smilingone Lv 1 6 pts. 9,516
  5. Avatar for reefyrob 15. reefyrob Lv 1 4 pts. 9,516
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 3 pts. 9,509
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 2 pts. 9,474
  8. Avatar for actiasluna 18. actiasluna Lv 1 2 pts. 9,474
  9. Avatar for bertro 19. bertro Lv 1 1 pt. 9,462
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 1 pt. 9,461

Comments