Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102

  1. Avatar for Jumbly 111. Jumbly Lv 1 2 pts. 8,436
  2. Avatar for rinze 112. rinze Lv 1 2 pts. 8,428
  3. Avatar for machinelves 113. machinelves Lv 1 2 pts. 8,411
  4. Avatar for Alistair69 114. Alistair69 Lv 1 2 pts. 8,408
  5. Avatar for rabamino12358 115. rabamino12358 Lv 1 2 pts. 8,407
  6. Avatar for navn 116. navn Lv 1 2 pts. 8,395
  7. Avatar for mitarcher 117. mitarcher Lv 1 2 pts. 8,385
  8. Avatar for RyeSnake 118. RyeSnake Lv 1 2 pts. 8,382
  9. Avatar for johngran 119. johngran Lv 1 2 pts. 8,375
  10. Avatar for senor pit 120. senor pit Lv 1 1 pt. 8,366

Comments