Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102

  1. Avatar for AeonFluff 121. AeonFluff Lv 1 1 pt. 8,361
  2. Avatar for talbers 122. talbers Lv 1 1 pt. 8,355
  3. Avatar for Pibeagles 123. Pibeagles Lv 1 1 pt. 8,344
  4. Avatar for Arne Heessels 124. Arne Heessels Lv 1 1 pt. 8,339
  5. Avatar for pandapharmd 125. pandapharmd Lv 1 1 pt. 8,286
  6. Avatar for lamoille 126. lamoille Lv 1 1 pt. 8,255
  7. Avatar for frostschutz 127. frostschutz Lv 1 1 pt. 8,246
  8. Avatar for 55SciOne 128. 55SciOne Lv 1 1 pt. 8,243
  9. Avatar for gu14012 129. gu14012 Lv 1 1 pt. 8,229
  10. Avatar for DScott 130. DScott Lv 1 1 pt. 8,220

Comments