Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102

  1. Avatar for Vinara 71. Vinara Lv 1 12 pts. 9,038
  2. Avatar for Bushman 72. Bushman Lv 1 11 pts. 9,031
  3. Avatar for Crossed Sticks 73. Crossed Sticks Lv 1 11 pts. 9,025
  4. Avatar for Jim Fraser 74. Jim Fraser Lv 1 10 pts. 9,024
  5. Avatar for Hiro Protagonist 75. Hiro Protagonist Lv 1 10 pts. 9,020
  6. Avatar for lupussapien 76. lupussapien Lv 1 10 pts. 9,000
  7. Avatar for Merf 77. Merf Lv 1 9 pts. 8,983
  8. Avatar for cbwest 78. cbwest Lv 1 9 pts. 8,980
  9. Avatar for SuperEnzyme 79. SuperEnzyme Lv 1 9 pts. 8,957
  10. Avatar for Deleted player 80. Deleted player pts. 8,912

Comments