Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102

  1. Avatar for dizzywings 81. dizzywings Lv 1 8 pts. 8,891
  2. Avatar for SKSbell 82. SKSbell Lv 1 8 pts. 8,859
  3. Avatar for tony46 83. tony46 Lv 1 7 pts. 8,856
  4. Avatar for Lord_c_nu 84. Lord_c_nu Lv 1 7 pts. 8,854
  5. Avatar for uihcv 85. uihcv Lv 1 7 pts. 8,844
  6. Avatar for georg137 86. georg137 Lv 1 6 pts. 8,794
  7. Avatar for fryguy 87. fryguy Lv 1 6 pts. 8,749
  8. Avatar for weitzen 88. weitzen Lv 1 6 pts. 8,743
  9. Avatar for Mr_Jolty 89. Mr_Jolty Lv 1 6 pts. 8,713
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 5 pts. 8,692

Comments