Placeholder image of a protein
Icon representing a puzzle

1354: Revisiting Puzzle 91: Virus Protein

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,605
  2. Avatar for Go Science 2. Go Science 81 pts. 9,563
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,521
  4. Avatar for HMT heritage 4. HMT heritage 50 pts. 9,518
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,474
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 30 pts. 9,473
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 9,455
  8. Avatar for Contenders 8. Contenders 17 pts. 9,448
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 9,125
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 9,102

  1. Avatar for gaving1 181. gaving1 Lv 1 1 pt. 7,225
  2. Avatar for BOB450 182. BOB450 Lv 1 1 pt. 7,201
  3. Avatar for BIO257C-pgguzman 183. BIO257C-pgguzman Lv 1 1 pt. 7,165
  4. Avatar for giffgiff1 184. giffgiff1 Lv 1 1 pt. 7,148
  5. Avatar for Gzxlm1234 185. Gzxlm1234 Lv 1 1 pt. 7,143
  6. Avatar for 01010011111 186. 01010011111 Lv 1 1 pt. 7,129
  7. Avatar for EnochRoot7 187. EnochRoot7 Lv 1 1 pt. 7,120
  8. Avatar for BIO257C-jabarca 188. BIO257C-jabarca Lv 1 1 pt. 7,003
  9. Avatar for simisola1 189. simisola1 Lv 1 1 pt. 6,871
  10. Avatar for TwistedM 190. TwistedM Lv 1 1 pt. 6,767

Comments