Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for toshiue
    1. toshiue Lv 1
    100 pts. 9,543
  2. Avatar for LociOiling 2. LociOiling Lv 1 83 pts. 9,541
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 68 pts. 9,541
  4. Avatar for pauldunn 4. pauldunn Lv 1 55 pts. 9,538
  5. Avatar for smilingone 5. smilingone Lv 1 44 pts. 9,536
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 35 pts. 9,533
  7. Avatar for reefyrob 7. reefyrob Lv 1 27 pts. 9,532
  8. Avatar for Hollinas 8. Hollinas Lv 1 21 pts. 9,532
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 16 pts. 9,531
  10. Avatar for Galaxie 10. Galaxie Lv 1 12 pts. 9,524

Comments