Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 4 pts. 8,628
  2. Avatar for dizzywings 92. dizzywings Lv 1 4 pts. 8,621
  3. Avatar for rsosborne 93. rsosborne Lv 1 4 pts. 8,609
  4. Avatar for Soggy Doglog 94. Soggy Doglog Lv 1 3 pts. 8,607
  5. Avatar for D001x_ErlandStevens 95. D001x_ErlandStevens Lv 1 3 pts. 8,596
  6. Avatar for lupussapien 96. lupussapien Lv 1 3 pts. 8,580
  7. Avatar for cinnamonkitty 97. cinnamonkitty Lv 1 3 pts. 8,539
  8. Avatar for SaraL 98. SaraL Lv 1 3 pts. 8,538
  9. Avatar for cobaltteal 99. cobaltteal Lv 1 3 pts. 8,529
  10. Avatar for AeonFluff 100. AeonFluff Lv 1 3 pts. 8,516

Comments