Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  6. Avatar for freefolder 17. freefolder 1 pt. 8,222
  7. Avatar for :) 18. :) 1 pt. 8,175
  8. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972

  1. Avatar for bcre8tvv 131. bcre8tvv Lv 1 1 pt. 7,987
  2. Avatar for Eric Yi 132. Eric Yi Lv 1 1 pt. 7,965
  3. Avatar for sarahgross 133. sarahgross Lv 1 1 pt. 7,960
  4. Avatar for Kiwegapa 134. Kiwegapa Lv 1 1 pt. 7,941
  5. Avatar for cherry39 135. cherry39 Lv 1 1 pt. 7,929
  6. Avatar for iON_Q 136. iON_Q Lv 1 1 pt. 7,896
  7. Avatar for joaniegirl 137. joaniegirl Lv 1 1 pt. 7,888
  8. Avatar for pielie 138. pielie Lv 1 1 pt. 7,888
  9. Avatar for trentis1 139. trentis1 Lv 1 1 pt. 7,862
  10. Avatar for ManVsYard 140. ManVsYard Lv 1 1 pt. 7,843

Comments