Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for Gaokerena 161. Gaokerena Lv 1 1 pt. 7,377
  2. Avatar for lamoille 162. lamoille Lv 1 1 pt. 7,096
  3. Avatar for martinf 163. martinf Lv 1 1 pt. 7,077
  4. Avatar for Smellgoo 164. Smellgoo Lv 1 1 pt. 7,055
  5. Avatar for severin333 165. severin333 Lv 1 1 pt. 7,009
  6. Avatar for doctaven 166. doctaven Lv 1 1 pt. 6,972
  7. Avatar for EXOICE 167. EXOICE Lv 1 1 pt. 6,899
  8. Avatar for Giantbluefish 168. Giantbluefish Lv 1 1 pt. 6,879
  9. Avatar for Tac1 169. Tac1 Lv 1 1 pt. 6,812
  10. Avatar for inkycatz 170. inkycatz Lv 1 1 pt. 6,795

Comments