Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for hallieprescott 171. hallieprescott Lv 1 1 pt. 6,719
  2. Avatar for andrewtmaxwell 172. andrewtmaxwell Lv 1 1 pt. 6,715
  3. Avatar for Batmanerd 173. Batmanerd Lv 1 1 pt. 6,697
  4. Avatar for brickwork 174. brickwork Lv 1 1 pt. 6,585
  5. Avatar for Hollinas 175. Hollinas Lv 1 1 pt. 6,565
  6. Avatar for Whitem 176. Whitem Lv 1 1 pt. 6,540
  7. Avatar for _Hex 177. _Hex Lv 1 1 pt. 6,540
  8. Avatar for RainBow DashRL34 178. RainBow DashRL34 Lv 1 1 pt. 6,224
  9. Avatar for JessicaDelgado21 179. JessicaDelgado21 Lv 1 1 pt. 6,176
  10. Avatar for immac636 180. immac636 Lv 1 1 pt. 6,106

Comments