Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 76 pts. 9,439
  2. Avatar for actiasluna 12. actiasluna Lv 1 74 pts. 9,438
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 72 pts. 9,425
  4. Avatar for smilingone 14. smilingone Lv 1 70 pts. 9,423
  5. Avatar for Keresto 15. Keresto Lv 1 68 pts. 9,422
  6. Avatar for shettler 16. shettler Lv 1 66 pts. 9,410
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 64 pts. 9,409
  8. Avatar for frood66 18. frood66 Lv 1 62 pts. 9,408
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 60 pts. 9,405
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 58 pts. 9,399

Comments