Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for joremen 21. joremen Lv 1 57 pts. 9,399
  2. Avatar for toshiue 22. toshiue Lv 1 55 pts. 9,397
  3. Avatar for Blipperman 23. Blipperman Lv 1 53 pts. 9,395
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 52 pts. 9,391
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 50 pts. 9,390
  6. Avatar for pauldunn 26. pauldunn Lv 1 48 pts. 9,388
  7. Avatar for Deleted player 27. Deleted player pts. 9,384
  8. Avatar for nicobul 28. nicobul Lv 1 46 pts. 9,384
  9. Avatar for katling 29. katling Lv 1 44 pts. 9,359
  10. Avatar for Scopper 30. Scopper Lv 1 43 pts. 9,355

Comments