Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for isaksson 41. isaksson Lv 1 30 pts. 9,282
  2. Avatar for guineapig 42. guineapig Lv 1 29 pts. 9,271
  3. Avatar for caglar 43. caglar Lv 1 28 pts. 9,260
  4. Avatar for randomlil 44. randomlil Lv 1 27 pts. 9,253
  5. Avatar for crpainter 45. crpainter Lv 1 26 pts. 9,253
  6. Avatar for stomjoh 46. stomjoh Lv 1 25 pts. 9,245
  7. Avatar for YeshuaLives 47. YeshuaLives Lv 1 24 pts. 9,244
  8. Avatar for dbuske 48. dbuske Lv 1 23 pts. 9,231
  9. Avatar for phi16 49. phi16 Lv 1 22 pts. 9,231
  10. Avatar for diamonddays 50. diamonddays Lv 1 22 pts. 9,230

Comments