Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Boinc.be 11. Boinc.be 3 pts. 8,924
  2. Avatar for xkcd 12. xkcd 2 pts. 8,776
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,697
  4. Avatar for Russian team 14. Russian team 1 pt. 8,678
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,609
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,596
  7. Avatar for freefolder 17. freefolder 1 pt. 8,222
  8. Avatar for :) 18. :) 1 pt. 8,175
  9. Avatar for Eὕρηκα! Heureka! 19. Eὕρηκα! Heureka! 1 pt. 7,798
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,972
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 21 pts. 9,230
  2. Avatar for cbwest 52. cbwest Lv 1 20 pts. 9,229
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 19 pts. 9,227
  4. Avatar for pfirth 54. pfirth Lv 1 19 pts. 9,202
  5. Avatar for Vinara 55. Vinara Lv 1 18 pts. 9,191
  6. Avatar for smholst 56. smholst Lv 1 17 pts. 9,190
  7. Avatar for Glen B 57. Glen B Lv 1 17 pts. 9,165
  8. Avatar for O Seki To 58. O Seki To Lv 1 16 pts. 9,152
  9. Avatar for hansvandenhof 59. hansvandenhof Lv 1 15 pts. 9,150
  10. Avatar for tarimo 60. tarimo Lv 1 15 pts. 9,149

Comments