Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Go Science 100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057

  1. Avatar for jermainiac 11. jermainiac Lv 1 9 pts. 9,523
  2. Avatar for Deleted player 12. Deleted player pts. 9,521
  3. Avatar for phi16 13. phi16 Lv 1 5 pts. 9,521
  4. Avatar for lamoille 14. lamoille Lv 1 4 pts. 9,518
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 3 pts. 9,457
  6. Avatar for gitwut 16. gitwut Lv 1 2 pts. 9,453
  7. Avatar for mimi 17. mimi Lv 1 1 pt. 9,451
  8. Avatar for Blipperman 18. Blipperman Lv 1 1 pt. 9,435
  9. Avatar for ManVsYard 19. ManVsYard Lv 1 1 pt. 9,432
  10. Avatar for Paulo Roque 20. Paulo Roque Lv 1 1 pt. 9,429

Comments