Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057
  1. Avatar for CH20XX 151. CH20XX Lv 1 1 pt. 7,702
  2. Avatar for Spikinours 152. Spikinours Lv 1 1 pt. 7,692
  3. Avatar for 01010011111 153. 01010011111 Lv 1 1 pt. 7,633
  4. Avatar for Superphosphate 154. Superphosphate Lv 1 1 pt. 7,630
  5. Avatar for yashoda 155. yashoda Lv 1 1 pt. 7,614
  6. Avatar for leehaggis 156. leehaggis Lv 1 1 pt. 7,481
  7. Avatar for frostschutz 157. frostschutz Lv 1 1 pt. 7,476
  8. Avatar for techbites457 158. techbites457 Lv 1 1 pt. 7,450
  9. Avatar for jebbiek 159. jebbiek Lv 1 1 pt. 7,449
  10. Avatar for Paulo Roque 160. Paulo Roque Lv 1 1 pt. 7,448

Comments