Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Deleted group 27. Deleted group pts. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,471
  2. Avatar for lamoille 2. lamoille Lv 1 80 pts. 9,463
  3. Avatar for gitwut 3. gitwut Lv 1 63 pts. 9,425
  4. Avatar for toshiue 4. toshiue Lv 1 49 pts. 9,423
  5. Avatar for ManVsYard 5. ManVsYard Lv 1 37 pts. 9,423
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 28 pts. 9,422
  7. Avatar for mimi 7. mimi Lv 1 21 pts. 9,422
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 15 pts. 9,419
  9. Avatar for Keresto 9. Keresto Lv 1 11 pts. 9,416
  10. Avatar for spvincent 10. spvincent Lv 1 8 pts. 9,415

Comments