Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Fold it NA3A Sundsgymnasiet 2021 26. Fold it NA3A Sundsgymnasiet 2021 1 pt. 3,217
  7. Avatar for Deleted group 27. Deleted group pts. 0
  1. Avatar for guineapig 41. guineapig Lv 1 28 pts. 8,726
  2. Avatar for NinjaGreg 42. NinjaGreg Lv 1 27 pts. 8,714
  3. Avatar for dizzywings 43. dizzywings Lv 1 26 pts. 8,697
  4. Avatar for MicElephant 44. MicElephant Lv 1 25 pts. 8,697
  5. Avatar for fishercat 45. fishercat Lv 1 24 pts. 8,676
  6. Avatar for toshiue 46. toshiue Lv 1 23 pts. 8,661
  7. Avatar for diamonddays 47. diamonddays Lv 1 22 pts. 8,658
  8. Avatar for lupussapien 48. lupussapien Lv 1 22 pts. 8,642
  9. Avatar for heather-1 49. heather-1 Lv 1 21 pts. 8,630
  10. Avatar for dssb 50. dssb Lv 1 20 pts. 8,626

Comments