Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Fold it NA3A Sundsgymnasiet 2021 26. Fold it NA3A Sundsgymnasiet 2021 1 pt. 3,217
  7. Avatar for Deleted group 27. Deleted group pts. 0
  1. Avatar for Glen B 61. Glen B Lv 1 13 pts. 8,524
  2. Avatar for pvc78 62. pvc78 Lv 1 12 pts. 8,487
  3. Avatar for uihcv 63. uihcv Lv 1 12 pts. 8,482
  4. Avatar for smholst 64. smholst Lv 1 11 pts. 8,478
  5. Avatar for stomjoh 65. stomjoh Lv 1 11 pts. 8,429
  6. Avatar for andrewxc 66. andrewxc Lv 1 10 pts. 8,415
  7. Avatar for Bushman 67. Bushman Lv 1 10 pts. 8,367
  8. Avatar for Jim Fraser 68. Jim Fraser Lv 1 10 pts. 8,360
  9. Avatar for rsosborne 69. rsosborne Lv 1 9 pts. 8,345
  10. Avatar for pfirth 70. pfirth Lv 1 9 pts. 8,334

Comments