Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Deleted group 27. Deleted group pts. 0

  1. Avatar for Grom 71. Grom Lv 1 8 pts. 8,321
  2. Avatar for alcor29 72. alcor29 Lv 1 8 pts. 8,311
  3. Avatar for ViJay7019 73. ViJay7019 Lv 1 8 pts. 8,276
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 7 pts. 8,273
  5. Avatar for O Seki To 75. O Seki To Lv 1 7 pts. 8,259
  6. Avatar for cbwest 76. cbwest Lv 1 7 pts. 8,239
  7. Avatar for philcalhoun 77. philcalhoun Lv 1 6 pts. 8,230
  8. Avatar for Reldas 78. Reldas Lv 1 6 pts. 8,209
  9. Avatar for JUMELLE54 79. JUMELLE54 Lv 1 6 pts. 8,176
  10. Avatar for Bletchley Park 80. Bletchley Park Lv 1 6 pts. 8,157

Comments