1360: Unsolved De-novo Freestyle 103
Closed since about 9 years ago
Intermediate Overall PredictionSummary
- Created
- March 31, 2017
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE