Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for BCH4103L 21. BCH4103L 1 pt. 5,769
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,340
  3. Avatar for LEC Metabolites 23. LEC Metabolites 1 pt. 4,891
  4. Avatar for BSM4601 24. BSM4601 1 pt. 3,837
  5. Avatar for SFASU_BIOL4356/5356 25. SFASU_BIOL4356/5356 1 pt. 3,781
  6. Avatar for Fold it NA3A Sundsgymnasiet 2021 26. Fold it NA3A Sundsgymnasiet 2021 1 pt. 3,217
  7. Avatar for Deleted group 27. Deleted group pts. 0
  1. Avatar for SKSbell 81. SKSbell Lv 1 5 pts. 8,147
  2. Avatar for Deleted player 82. Deleted player pts. 8,144
  3. Avatar for trentis1 83. trentis1 Lv 1 5 pts. 8,074
  4. Avatar for SaraL 84. SaraL Lv 1 5 pts. 8,052
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 4 pts. 8,052
  6. Avatar for deLaCeiba 86. deLaCeiba Lv 1 4 pts. 8,049
  7. Avatar for dbuske 87. dbuske Lv 1 4 pts. 8,032
  8. Avatar for YGK 88. YGK Lv 1 4 pts. 8,026
  9. Avatar for andrewtmaxwell 89. andrewtmaxwell Lv 1 4 pts. 7,986
  10. Avatar for bcre8tvv 90. bcre8tvv Lv 1 3 pts. 7,945

Comments