Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,472
  2. Avatar for Gargleblasters 2. Gargleblasters 83 pts. 9,436
  3. Avatar for Go Science 3. Go Science 68 pts. 9,429
  4. Avatar for Contenders 4. Contenders 55 pts. 9,425
  5. Avatar for Beta Folders 5. Beta Folders 44 pts. 9,257
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 9,155
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 8,989
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 21 pts. 8,880
  9. Avatar for Russian team 9. Russian team 16 pts. 8,734
  10. Avatar for Deleted group 10. Deleted group pts. 8,577

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,471
  2. Avatar for lamoille 2. lamoille Lv 1 80 pts. 9,463
  3. Avatar for gitwut 3. gitwut Lv 1 63 pts. 9,425
  4. Avatar for toshiue 4. toshiue Lv 1 49 pts. 9,423
  5. Avatar for ManVsYard 5. ManVsYard Lv 1 37 pts. 9,423
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 28 pts. 9,422
  7. Avatar for mimi 7. mimi Lv 1 21 pts. 9,422
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 15 pts. 9,419
  9. Avatar for Keresto 9. Keresto Lv 1 11 pts. 9,416
  10. Avatar for spvincent 10. spvincent Lv 1 8 pts. 9,415

Comments