Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,472
  2. Avatar for Gargleblasters 2. Gargleblasters 83 pts. 9,436
  3. Avatar for Go Science 3. Go Science 68 pts. 9,429
  4. Avatar for Contenders 4. Contenders 55 pts. 9,425
  5. Avatar for Beta Folders 5. Beta Folders 44 pts. 9,257
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 9,155
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 8,989
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 21 pts. 8,880
  9. Avatar for Russian team 9. Russian team 16 pts. 8,734
  10. Avatar for Deleted group 10. Deleted group pts. 8,577
  1. Avatar for yashoda 141. yashoda Lv 1 1 pt. 5,887
  2. Avatar for Pachypodium 142. Pachypodium Lv 1 1 pt. 5,804
  3. Avatar for mmitchell51 143. mmitchell51 Lv 1 1 pt. 5,769
  4. Avatar for talbers 144. talbers Lv 1 1 pt. 5,736
  5. Avatar for Deleted player 145. Deleted player pts. 5,621
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 5,488
  7. Avatar for halberstram 147. halberstram Lv 1 1 pt. 5,428
  8. Avatar for pooja chennupati 148. pooja chennupati Lv 1 1 pt. 5,421
  9. Avatar for doctaven 149. doctaven Lv 1 1 pt. 5,340
  10. Avatar for saksoft2 150. saksoft2 Lv 1 1 pt. 5,303

Comments