Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  6. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  7. Avatar for :) 18. :) 1 pt. 8,492
  8. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194

  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 9,530
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 9,473
  3. Avatar for LociOiling 3. LociOiling Lv 1 95 pts. 9,467
  4. Avatar for markm457 4. markm457 Lv 1 92 pts. 9,462
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 90 pts. 9,438
  6. Avatar for pauldunn 6. pauldunn Lv 1 87 pts. 9,414
  7. Avatar for caglar 7. caglar Lv 1 85 pts. 9,408
  8. Avatar for actiasluna 8. actiasluna Lv 1 82 pts. 9,399
  9. Avatar for eromana 9. eromana Lv 1 80 pts. 9,398
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 77 pts. 9,370

Comments