Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  6. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  7. Avatar for :) 18. :) 1 pt. 8,492
  8. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194

  1. Avatar for senor pit 131. senor pit Lv 1 1 pt. 8,209
  2. Avatar for goday_yashika 132. goday_yashika Lv 1 1 pt. 8,194
  3. Avatar for cnhrcolemam 133. cnhrcolemam Lv 1 1 pt. 8,169
  4. Avatar for jebbiek 134. jebbiek Lv 1 1 pt. 8,168
  5. Avatar for trentis1 135. trentis1 Lv 1 1 pt. 8,164
  6. Avatar for jbmkfm125 136. jbmkfm125 Lv 1 1 pt. 8,111
  7. Avatar for Germes 137. Germes Lv 1 1 pt. 8,103
  8. Avatar for imaninja329 138. imaninja329 Lv 1 1 pt. 8,098
  9. Avatar for martinf 139. martinf Lv 1 1 pt. 8,095
  10. Avatar for Alistair69 140. Alistair69 Lv 1 1 pt. 8,075

Comments