Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  6. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  7. Avatar for :) 18. :) 1 pt. 8,492
  8. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194

  1. Avatar for Nick_Flamel 151. Nick_Flamel Lv 1 1 pt. 7,825
  2. Avatar for Gaokerena 152. Gaokerena Lv 1 1 pt. 7,818
  3. Avatar for donckypoop 153. donckypoop Lv 1 1 pt. 7,789
  4. Avatar for i8kraft 154. i8kraft Lv 1 1 pt. 7,764
  5. Avatar for Bpoli7 155. Bpoli7 Lv 1 1 pt. 7,748
  6. Avatar for science-mathguy 156. science-mathguy Lv 1 1 pt. 7,740
  7. Avatar for doctaven 157. doctaven Lv 1 1 pt. 7,709
  8. Avatar for avisnofsky 158. avisnofsky Lv 1 1 pt. 7,690
  9. Avatar for NotJim99 159. NotJim99 Lv 1 1 pt. 7,675
  10. Avatar for ralan-nsk 160. ralan-nsk Lv 1 1 pt. 7,672

Comments