Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  6. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  7. Avatar for :) 18. :) 1 pt. 8,492
  8. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194

  1. Avatar for O Seki To 11. O Seki To Lv 1 75 pts. 9,367
  2. Avatar for gitwut 12. gitwut Lv 1 73 pts. 9,366
  3. Avatar for tokens 13. tokens Lv 1 71 pts. 9,356
  4. Avatar for eusair 14. eusair Lv 1 69 pts. 9,354
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 67 pts. 9,353
  6. Avatar for mimi 16. mimi Lv 1 65 pts. 9,339
  7. Avatar for reefyrob 17. reefyrob Lv 1 63 pts. 9,337
  8. Avatar for Deleted player 18. Deleted player pts. 9,332
  9. Avatar for Galaxie 19. Galaxie Lv 1 59 pts. 9,321
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 57 pts. 9,320

Comments