Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 2 pts. 8,728
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  8. Avatar for :) 18. :) 1 pt. 8,492
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 8,310
  10. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194
  1. Avatar for Keresto 31. Keresto Lv 1 40 pts. 9,261
  2. Avatar for Deleted player 32. Deleted player pts. 9,258
  3. Avatar for Blipperman 33. Blipperman Lv 1 37 pts. 9,249
  4. Avatar for crpainter 34. crpainter Lv 1 36 pts. 9,248
  5. Avatar for Glen B 35. Glen B Lv 1 35 pts. 9,234
  6. Avatar for randomlil 36. randomlil Lv 1 34 pts. 9,217
  7. Avatar for Grom 37. Grom Lv 1 32 pts. 9,215
  8. Avatar for Vredeman 38. Vredeman Lv 1 31 pts. 9,205
  9. Avatar for stomjoh 39. stomjoh Lv 1 30 pts. 9,204
  10. Avatar for Norrjane 40. Norrjane Lv 1 29 pts. 9,199

Comments