Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 2 pts. 8,728
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  8. Avatar for :) 18. :) 1 pt. 8,492
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 8,310
  10. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194
  1. Avatar for alwen 41. alwen Lv 1 28 pts. 9,194
  2. Avatar for katling 42. katling Lv 1 27 pts. 9,191
  3. Avatar for guineapig 43. guineapig Lv 1 26 pts. 9,185
  4. Avatar for Vinara 44. Vinara Lv 1 25 pts. 9,174
  5. Avatar for georg137 45. georg137 Lv 1 24 pts. 9,167
  6. Avatar for isaksson 46. isaksson Lv 1 23 pts. 9,167
  7. Avatar for Museka 47. Museka Lv 1 22 pts. 9,154
  8. Avatar for diamonddays 48. diamonddays Lv 1 22 pts. 9,154
  9. Avatar for jermainiac 49. jermainiac Lv 1 21 pts. 9,151
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 20 pts. 9,144

Comments