Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 9,047
  2. Avatar for Kotocycle 12. Kotocycle 5 pts. 8,978
  3. Avatar for xkcd 13. xkcd 4 pts. 8,739
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 3 pts. 8,730
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 2 pts. 8,728
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,666
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,608
  8. Avatar for :) 18. :) 1 pt. 8,492
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 8,310
  10. Avatar for GUGITBIOTECH 20. GUGITBIOTECH 1 pt. 8,194
  1. Avatar for smilingone 51. smilingone Lv 1 19 pts. 9,144
  2. Avatar for phi16 52. phi16 Lv 1 19 pts. 9,143
  3. Avatar for tony46 53. tony46 Lv 1 18 pts. 9,131
  4. Avatar for dssb 54. dssb Lv 1 17 pts. 9,116
  5. Avatar for MicElephant 55. MicElephant Lv 1 17 pts. 9,110
  6. Avatar for cbwest 56. cbwest Lv 1 16 pts. 9,109
  7. Avatar for jobo0502 57. jobo0502 Lv 1 15 pts. 9,090
  8. Avatar for deLaCeiba 58. deLaCeiba Lv 1 15 pts. 9,047
  9. Avatar for jamiexq 59. jamiexq Lv 1 14 pts. 9,023
  10. Avatar for ViJay7019 60. ViJay7019 Lv 1 13 pts. 8,999

Comments