Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for Mr_Jolty 91. Mr_Jolty Lv 1 3 pts. 8,666
  2. Avatar for Flagg65a 92. Flagg65a Lv 1 3 pts. 8,652
  3. Avatar for uihcv 93. uihcv Lv 1 3 pts. 8,650
  4. Avatar for ManVsYard 94. ManVsYard Lv 1 3 pts. 8,648
  5. Avatar for rabamino12358 95. rabamino12358 Lv 1 3 pts. 8,643
  6. Avatar for Jim Fraser 96. Jim Fraser Lv 1 3 pts. 8,637
  7. Avatar for cobaltteal 97. cobaltteal Lv 1 2 pts. 8,634
  8. Avatar for harvardman 98. harvardman Lv 1 2 pts. 8,629
  9. Avatar for dizzywings 99. dizzywings Lv 1 2 pts. 8,629
  10. Avatar for JUMELLE54 100. JUMELLE54 Lv 1 2 pts. 8,618

Comments