Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 1 pt. 8,388
  2. Avatar for Deleted player 112. Deleted player pts. 8,359
  3. Avatar for AeonFluff 113. AeonFluff Lv 1 1 pt. 8,357
  4. Avatar for frostschutz 114. frostschutz Lv 1 1 pt. 8,357
  5. Avatar for jtrube1 115. jtrube1 Lv 1 1 pt. 8,347
  6. Avatar for joaniegirl 116. joaniegirl Lv 1 1 pt. 8,342
  7. Avatar for leehaggis 117. leehaggis Lv 1 1 pt. 8,330
  8. Avatar for DScott 118. DScott Lv 1 1 pt. 8,324
  9. Avatar for navn 119. navn Lv 1 1 pt. 8,321
  10. Avatar for MuckeMcFly 120. MuckeMcFly Lv 1 1 pt. 8,310

Comments