Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for tweak64 121. tweak64 Lv 1 1 pt. 8,309
  2. Avatar for demeter900 122. demeter900 Lv 1 1 pt. 8,308
  3. Avatar for Hollinas 123. Hollinas Lv 1 1 pt. 8,301
  4. Avatar for Iron pet 124. Iron pet Lv 1 1 pt. 8,289
  5. Avatar for Pibeagles 125. Pibeagles Lv 1 1 pt. 8,283
  6. Avatar for dam_01 126. dam_01 Lv 1 1 pt. 8,236
  7. Avatar for Superphosphate 127. Superphosphate Lv 1 1 pt. 8,227
  8. Avatar for MadCat08 128. MadCat08 Lv 1 1 pt. 8,217
  9. Avatar for SouperGenious 129. SouperGenious Lv 1 1 pt. 8,216
  10. Avatar for pandapharmd 130. pandapharmd Lv 1 1 pt. 8,212

Comments