Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for Nick_Flamel 151. Nick_Flamel Lv 1 1 pt. 7,825
  2. Avatar for Gaokerena 152. Gaokerena Lv 1 1 pt. 7,818
  3. Avatar for donckypoop 153. donckypoop Lv 1 1 pt. 7,789
  4. Avatar for i8kraft 154. i8kraft Lv 1 1 pt. 7,764
  5. Avatar for Bpoli7 155. Bpoli7 Lv 1 1 pt. 7,748
  6. Avatar for science-mathguy 156. science-mathguy Lv 1 1 pt. 7,740
  7. Avatar for doctaven 157. doctaven Lv 1 1 pt. 7,709
  8. Avatar for avisnofsky 158. avisnofsky Lv 1 1 pt. 7,690
  9. Avatar for NotJim99 159. NotJim99 Lv 1 1 pt. 7,675
  10. Avatar for ralan-nsk 160. ralan-nsk Lv 1 1 pt. 7,672

Comments