Placeholder image of a protein
Icon representing a puzzle

1362: Revisiting Puzzle 94: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for SFASU_BIOL4356/5356 21. SFASU_BIOL4356/5356 1 pt. 7,977
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 7,709
  3. Avatar for BioChem22017 23. BioChem22017 1 pt. 6,881
  4. Avatar for Deleted group 24. Deleted group pts. 3,880
  5. Avatar for Window Group 25. Window Group 1 pt. 3,880
  1. Avatar for alwen 41. alwen Lv 1 28 pts. 9,194
  2. Avatar for katling 42. katling Lv 1 27 pts. 9,191
  3. Avatar for guineapig 43. guineapig Lv 1 26 pts. 9,185
  4. Avatar for Vinara 44. Vinara Lv 1 25 pts. 9,174
  5. Avatar for georg137 45. georg137 Lv 1 24 pts. 9,167
  6. Avatar for isaksson 46. isaksson Lv 1 23 pts. 9,167
  7. Avatar for Museka 47. Museka Lv 1 22 pts. 9,154
  8. Avatar for diamonddays 48. diamonddays Lv 1 22 pts. 9,154
  9. Avatar for jermainiac 49. jermainiac Lv 1 21 pts. 9,151
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 20 pts. 9,144

Comments